PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g08100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 312aa    MW: 35339.6 Da    PI: 7.5919
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g08100genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.83e-30113169258
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                dDgy+WrKYGqK++k+s++prsYY+Ct + C++kk+vers ++p++  itYeg H h
  Tp2g08100 113 DDGYKWRKYGQKSIKNSPNPRSYYKCTNPICNAKKQVERSIDEPNTYLITYEGFHFH 169
                8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.7E-28106169IPR003657WRKY domain
PROSITE profilePS5081126.349107169IPR003657WRKY domain
SuperFamilySSF1182902.62E-25111169IPR003657WRKY domain
SMARTSM007741.9E-35112171IPR003657WRKY domain
PfamPF031061.5E-24113169IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAEEELSEWT RRCGNGAVDE LFVNEPPLFF LPQEQHISLM PDEDSITNTL VSSKLYSGPR  60
IEDIAHALAV VQPLTHPLRQ ISESTVSKLG RSTLGMVDRY TLKVKNSCNG ISDDGYKWRK  120
YGQKSIKNSP NPRSYYKCTN PICNAKKQVE RSIDEPNTYL ITYEGFHFHF TYPFFLPNST  180
HRPDKKPKIL KHDARYRAHF EINQKSQTQE ENKQAELVEP TYQNHQAVHG NTPGSLEGEL  240
FFPHDRCRQR QGLLEDVVAP AMKNIPTNDS VLAASWSSLS SYTSSSCSSS RTSSPPLSPS  300
SLCWSPNFHM GI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-181131691874Probable WRKY transcription factor 4
2lex_A1e-181131691874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013747202.11e-151PREDICTED: probable WRKY transcription factor 49
SwissprotQ9FHR71e-138WRK49_ARATH; Probable WRKY transcription factor 49
TrEMBLM4EFB81e-146M4EFB8_BRARP; Uncharacterized protein
STRINGBra027480.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94052637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-135WRKY DNA-binding protein 49